SAB1410898

Anti-MECR antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(s): CGI-63, FASN2B, NRBF1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 40.5 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_016011.2
• UniProt accession no.: Q9BV79
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MECR(51102)

Description

General description

MECR (Mitochondrial trans-2-enoyl-CoA reductase) is a mitochondrial localized protein, also referred to as nuclear receptor binding factor-1 (NRBF-1). It consists of N-terminal mitochondrial targeting sequence, which plays an essential role for its mitochondrial localization. It was firstly identified as a binding protein of the nuclear hormone receptor peroxisome proliferator-activated receptor (PPARα).

Immunogen

MECR (NP_057095.2, 1 a.a. ~ 373 a.a) full-length human protein.

Sequence
MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Biochem/physiol Actions

MECR (Mitochondrial trans-2-enoyl-CoA reductase) plays a vital role in the intracellular signaling pathways of fatty acid elongation cycle pathway. In the nuclei, it catalyzes reduction reaction of trans-2-enoyl thioesters to the corresponding saturated acyl thioesters in the presence of NADPH. It has also been reported that MECR acts as a component of the mitochondrial FAS II (fatty acid synthesis II) pathway and enhances the PPARa-dependent luciferase activity in HeLa cells.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable