SAB1402991

Monoclonal Anti-BLZF1, (C-terminal) antibody produced in mouse

clone 2E10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): GOLGIN-45, JEM-1, JEM-1s, JEM1, MGC22497
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E10, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_003666
• UniProt accession no.: Q9H2G9
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BLZF1(8548)

Description

General description

Mouse monoclonal antibody raised against a partial recombinant BLZF1.
The gene BLZF1 (basic leucine zipper nuclear factor 1) is mapped to human chromosome 1q24. It belongs to the b-ZIP family of proteins. The encoded protein has a PEST (proline [P], glutamic acid [E], serine [S], and threonine [T]) motif, a putative leucine repeat and several phosphorylation sites. This protein is present in the nucleus, cytoplasm and Golgi apparatus.

Immunogen

BLZF1 (NP_003657, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL

Biochem/physiol Actions

BLZF1 (basic leucine zipper nuclear factor 1) might work as a transcription factor. It is involved in epigenetic regulation by binding to DNMT3L (DNA methyltransferase 3 like) and also participates in Wnt/β-catenin signaling. The BLZF1 gene is downregulated in acute promyelocytic leukemia (APL) cell line NB4. On the other hand, it is upregulated in presence of dengue virus infection. BLZF1 also interacts with GRASP55 (the medial-Golgi matrix protein) and the GTP form of rab2. It is involved in the secretory protein transport and maintenance of the Golgi structure. This gene is downregulated in hepatocellular carcinoma. This low expression is associated with poor overall survival.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable