MSST0045
SILu™Prot TIMP2, Metalloproteinase inhibitor 2 human
recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
23201100
NACRES:
NA.12
Recommended Products
Related Categories
General description
SILu™Prot TIMP2 is a recombinant, stable isotope-labeled human TIMP2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP2 in mass-spectrometry. SILu™Prot TIMP2 is a protein of 194 amino acids , with a calculated molecular mass of 21.7 kDa.
Biochem/physiol Actions
While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.
Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class
11 - Combustible Solids
wgk_germany
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service