Skip to Content
MilliporeSigma
All Photos(7)

Key Documents

HPA030917

Sigma-Aldrich

Anti-MX1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-IFI-78K, Anti-MxA, Anti-myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MX1(4599)

General description

MX1 (Myxoma resistance protein 1) gene is mapped to human chromosome 21q22.3. MX1 is very similar to membrane-remodeling fission GTPases, such as dynamin. The protein has a molecular weight of 70kDa, and contains an amino-terminal globular GTPase domain and a carboxy-terminal stalk domain.

Immunogen

MX dynamin-like GTPase 1

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MX1 antibody produced in rabbit has been used in western blotting and ELISA.

Biochem/physiol Actions

MX1 (Myxoma resistance protein 1) is an interferon-induced dynamin-like GTPase with a broad spectrum antiviral activity. It restricts the replication of many RNA and DNA viruses. At the biochemical level, MX1 proteins bind to intracellular membrane leading to membrane bending and tubulation, also forming dimers and multimeric rings that might interact with the viral structures. MX1 might be associated with pulmonary arterial hypertension pathogenesis, by affecting the BMP (bone morphogenetic proteins)4 and 9 signaling. MX1 serves as an important marker in the diagnosis of dermatomyositis. Genetic variation in MX1 might contribute to systemic lupus erythematosus susceptibility and chronic hepatitis C virus progression.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78815

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Association of Myxovirus Resistance Gene Promoter Polymorphism with Response to Combined Interferon Treatment and Progression of Liver Disease in Chronic HCV Egyptian Patients.
Bader El Din NG
Journal of Interferon & Cytokine Research, 35(8), 641-648 (2015)
Transient dimerization of human MxA promotes GTP hydrolysis, resulting in a mechanical power stroke.
Rennie ML
Structure, 22(10), 1433-1445 (2014)
Oligomerization and GTP-binding Requirements of MxA for Viral Target Recognition and Antiviral Activity against Influenza A Virus.
Nigg PE and Pavlovic J
The Journal of Biological Chemistry, 290(50), 29893-29906 (2015)
MxA Is a Novel Regulator of Endosome-Associated Transcriptional Signaling by Bone Morphogenetic Proteins 4 and 9 (BMP4 and BMP9).
Yuan H and Sehgal PB
PLoS ONE, 11(11) (2016)
Proteomics profiling identify CAPS as a potential predictive marker of tamoxifen resistance in estrogen receptor positive breast cancer.
Johansson HJ
Clinical Proteomics, 12(1), 8-8 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service