Skip to Content
MilliporeSigma
All Photos(5)

Key Documents

HPA006458

Sigma-Aldrich

Anti-TOP2A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-TOP2A_HUMAN Isoform 2 of P11388 - Homo sapiens

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TOP2A(7153)

General description

TOP2A (topoisomerase (DNA) IIα) is a nuclear enzyme, which has a molecular weight of 170kDa. This gene is localized to human chromosome 17q21-q22. Along with TOP2β, it forms the two isoforms of TOP2 enzyme. It is a ubiquitously expressed homodimeric protein. Its N-terminal contains the ATP-binding and hydrolysis sites. It also contains the catalytic central domain, and the C-terminal containing the DNA-recognition site.

Immunogen

TOP2A_HUMAN Isoform 2 of P11388 - Homo sapiens recombinant protein epitope signature tag (PrEST)

Application

Anti-TOP2A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

TOP2A (topoisomerase (DNA) IIα) regulates chromosome segregation, progression of cell cycle and the topological structure of DNA. It acts as a target of multiple drugs such as, anthracyclines (doxorubicin, epirubicin) and epipodophyllotoxins (etoposide, teniposide). In HER2 (human epithelial growth factor receptor-2)-amplified breast cancer, this gene is also amplified. This gene is up-regulated in multiple cancers such as, hepatocellular carcinoma (HCC), prostate and gastric cancer. In renal cell carcinoma patients, overexpression of this gene is linked to poor survival rates.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70242

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Christine J Farr et al.
Nucleic acids research, 42(7), 4414-4426 (2014-01-31)
As proliferating cells transit from interphase into M-phase, chromatin undergoes extensive reorganization, and topoisomerase (topo) IIα, the major isoform of this enzyme present in cycling vertebrate cells, plays a key role in this process. In this study, a human cell
Alexander S Parker et al.
European urology, 66(5), 929-935 (2014-01-07)
Tumor-based biomarkers of outcome for patients with clear cell renal cell carcinoma (ccRCC) remain limited, especially for those with low-risk disease. Type IIa topoisomerase (TOPOIIa) is a well-known biomarker of DNA replication and a target for antineoplastic agents, but it
Wei Guo et al.
Journal of cancer research and clinical oncology, 146(4), 821-841 (2020-02-28)
Lung cancer has the highest morbidity and mortality among all cancer types. Reliable prognostic biomarkers are needed to identify high-risk patients apart from TNM system for precision medicine. The present study is designed to identify robust prognostic biomarkers in lung
D S Kodiakov et al.
Voprosy onkologii, 60(2), 63-68 (2014-06-13)
Investigated topoisomerase IIalpha (TopoII alpha), argyrophilic proteins associated with nucleolar organizer regions (Ag-NOR) and antigen Ki-67 in lung adenocarcinoma. Defined tumor with low and high TopoII alpha, Ag-NOR and Ki-67. TopoII alpha had a relationship with clinical and morphological parameters
R Hunter Lindsey et al.
Biochemistry, 53(41), 6595-6602 (2014-10-04)
Coordination between the N-terminal gate and the catalytic core of topoisomerase II allows the proper capture, cleavage, and transport of DNA during the catalytic cycle. Because the activities of these domains are tightly linked, it has been difficult to discern

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service