Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV46474

Sigma-Aldrich

Anti-RARRES3 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-HRASLS4, Anti-MGC8906, Anti-RIG1, Anti-Retinoic acid receptor responder (tazarotene induced) 3, Anti-TIG3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

18 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... RARRES3(5920)

General description

Retinoic acid receptor responder (tazarotene induced) 3 (RARRES3, HRASLS4), a member of the steroid and thyroid hormone receptor superfamily of transcription factors, is induced by the synthetic retinoid tazarotene. RARRES3/TIG3 of the lecithin retinol acyltransferase (LRAT) protein family is a member of the HREV107 family of class II tumor suppressors which are down-regulated in various cancer cells. RARRES3/TIG3 is involved in phospholipids metabolism.

Specificity

Anti-RARRES3 polyclonal antibody reacts with human retinoic acid receptor responder (tazarotene induced) 3.

Immunogen

Synthetic peptide directed towards the middle region of human RARRES3

Application

Anti-RARRES3 polyclonal antibody is used to tag retinoic acid receptor responder (tazarotene induced) 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles protein retinoic acid receptor responder (tazarotene induced) 3 in phospholipid metabolism and tumor suppression.

Biochem/physiol Actions

Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator.

Sequence

Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service