Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

AV31175

Sigma-Aldrich

Anti-E2F4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-E2F transcription factor 4, p107/p130-binding

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

mouse, rabbit, guinea pig, rat, bovine, dog, human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: 4-8 μg/mL (Paraffin-embedded Tissue)
western blot: suitable

NCBI accession no.

NP_001941

UniProt accession no.

Q16254

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... E2F4(1874)

Related Categories

Immunogen

Synthetic peptide directed towards the C terminal region of human E2F4

Application

Rabbit Anti-E2F4 antibody can be used for western blot (2.0μg/ml) and IHC (4-8μg/ml) applications.

Biochem/physiol Actions

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins. It is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It also plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

Sequence

Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC826
QC0826

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

P O Humbert et al.
Molecular cell, 6(2), 281-291 (2000-09-13)
The retinoblastoma protein (pRB) plays a key role in the control of normal development and proliferation through the regulation of the E2F transcription factors. We generated a mutant mouse model to assess the in vivo role of the predominant E2F
Chang-Rung Chen et al.
Cell, 110(1), 19-32 (2002-08-02)
Smad3 is a direct mediator of transcriptional activation by the TGFbeta receptor. Its target genes in epithelial cells include cyclin-dependent kinase inhibitors that generate a cytostatic reponse. We defined how, in the same context, Smad3 can also mediate transcriptional repression
S Gaubatz et al.
Molecular cell, 6(3), 729-735 (2000-10-13)
E2F transcription factors are major regulators of cell proliferation. The diversity of the E2F family suggests that individual members perform distinct functions in cell cycle control. E2F4 and E2F5 constitute a defined subset of the family. Until now, there has

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service