AV100832
Anti-GABPA antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-GA binding protein transcription factor, α subunit 60 kDa
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
51 kDa
species reactivity
dog, horse, human, bovine, mouse, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GABPA(2551)
General description
GA-binding protein (GABP) is a member of Ets family of transcription factors that functions as a heterodimer. The α subunit binds to DNA while the β subunit enables transactivation of the target genes.
Immunogen
Synthetic peptide directed towards the C terminal region of human GABPA
Application
Anti-GABPA antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions
GABPA subunit has a distinct role cell cycle progression, embryogenesis and synaptic function at neuromuscular junctions. It is reported to regulate the cell migration and cytoskeletal changes in breast epithelial cells.
Sequence
Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Zaneta Odrowaz et al.
PloS one, 7(12), e49892-e49892 (2013-01-04)
Members of the ETS transcription factor family often target the same binding regions and hence have the potential to regulate the same genes and downstream biological processes. However, individual family members also preferentially bind to other genomic regions, thus providing
F C de la Brousse et al.
Genes & development, 8(15), 1853-1865 (1994-08-01)
This report outlines three observations relating to GABP beta, a polypeptide constituent of the heterotetrameric transcription factor GABP. Evidence is presented showing that the mouse genome encodes two highly related GABP beta polypeptides, designated GABP beta 1-1 and GABP beta
Xuefang Jing et al.
The Journal of biological chemistry, 283(36), 24326-24333 (2008-07-17)
GA-binding protein (GABP) is the only Ets family transcription factor that functions as a heterodimer. The GABPalpha subunit binds to DNA, and the GABPbeta subunit possesses the ability to transactivate target genes. Inactivation of GABPalpha caused embryonic lethality and defective
M Armoni et al.
Hormone and metabolic research = Hormon- und Stoffwechselforschung = Hormones et metabolisme, 46(7), 477-483 (2014-02-07)
Impaired GLUT4 function/expression in insulin target tissues is well-documented in diabetes and obesity. Cytochrome P450 isoform 2E1 (CYP2E1) induces oxidative stress, leading to impaired insulin action. CYP2E1 knockout mice are protected against high fat diet-induced insulin resistance and obesity; however
Wan Zhu et al.
Autophagy, 10(9), 1622-1636 (2014-07-22)
Macroautophagy is a vesicular catabolic trafficking pathway that is thought to protect cells from diverse stressors and to promote longevity. Recent studies have revealed that transcription factors play important roles in the regulation of autophagy. In this study, we have
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service