SAB1413282

Monoclonal Anti-SEC24A antibody produced in mouse

clone 4D9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): SEC24A
• UNSPSC Code: 51111800

Properties

• conjugate: unconjugated
• Quality Level: 100
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4D9, monoclonal
• form: buffered aqueous solution
• mol wt: 35.64 kDa
• species reactivity: human
• concentration: ~0.3-1 μg/μL (Please refer to lot specific concentration)
• technique(s): ELISA: suitable; western blot: suitable
• isotype: IgG2a, kappa
• Protein ID accession no.: XM_094581
• shipped in: dry ice
• storage temp.: -10 to -25°C
• target post-translational modification: unmodified
• Gene Information: human ... SEC24A(10802)

Description

General description

Mouse monoclonal antibody raised against a partial recombinant SEC24A.

Immunogen

SEC24A (XP_094581.5, 301 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence

PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSL

Physical form

Solution in phosphate buffered saline, pH 7.4

Preparation Note

Purification by Protein A sepharose

Storage and Stability

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable