Skip to Content
Merck
All Photos(1)

Key Documents

AV46356

Sigma-Aldrich

Anti-LMNB2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-LAMB2, Anti-LMN2, Anti-Lamin B2, Anti-MGC2721

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

68 kDa

species reactivity

bovine, horse, guinea pig, mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LMNB2(84823)

Immunogen

Synthetic peptide directed towards the N terminal region of human LMNB2

Application

Anti-LMNB2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Biochem/physiol Actions

LMNB2 (lamin B2) gene also referred to as LAMB2, LMN2, or MGC2721 encodes for a B type nuclear lamin. Lamins consist of two types, A and B, and are involved in nuclear stability chromatin structure and gene expression. Lamin B which is a structural component of the interphase nuclear lamina facilitates the stimulation of microtubule assembly and organization in mitosis. Mutation in LMNB2 gene leads to acquired partial lipodystrophy.

Sequence

Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Thomas Dechat et al.
Genes & development, 22(7), 832-853 (2008-04-03)
Over the past few years it has become evident that the intermediate filament proteins, the types A and B nuclear lamins, not only provide a structural framework for the nucleus, but are also essential for many aspects of normal nuclear
Jinzhi Gao et al.
Journal of pediatric endocrinology & metabolism : JPEM, 25(3-4), 375-377 (2012-07-10)
Acquired partial lipodystrophy (APL) is a rare disorder, mainly characterized by progressive loss of subcutaneous fatty tissue, starting from the face and spreading to the upper part of the body. The etiology of APL is unknown. It may be caused
Roopali Pradhan et al.
Nucleic acids research, 46(11), 5561-5586 (2018-04-24)
Cells perceive and relay external mechanical forces into the nucleus through the nuclear envelope. Here we examined the effect of lowering substrate stiffness as a paradigm to address the impact of altered mechanical forces on nuclear structure-function relationships. RNA sequencing
Ming-Ying Tsai et al.
Science (New York, N.Y.), 311(5769), 1887-1893 (2006-03-18)
Mitotic spindle morphogenesis is a series of highly coordinated movements that lead to chromosome segregation and cytokinesis. We report that the intermediate filament protein lamin B, a component of the interphase nuclear lamina, functions in spindle assembly. Lamin B assembled

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service