AV34182

Anti-CSRP3 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Cysteine and glycine-rich protein 3 (cardiac LIM protein)
• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 21 kDa
• species reactivity: rabbit, human, mouse, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001121128
• UniProt accession no.: P50461
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CSRP3(8048)

Description

General description

CSRP3 is a LIM domain protein that may modulate cell growth and differentiation. Studies in rat wheel-lock (WL) models for depressed ambulatory activity have revealed low Csrp3 protein levels. Moreover, CSRP3 mutations have been linked to hypertrophic cardiomyopathy.
Rabbit Anti-CSRP3 recognizes human, canine, rat, mouse, bovine, and pig CSRP3.

Immunogen

Synthetic peptide directed towards the C terminal region of human CSRP3

Application

Rabbit Anti-CSRP3 can be used for western blot applications at 0.125 μg/ml.

Biochem/physiol Actions

This CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans.

Sequence

Synthetic peptide located within the following region: FRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable