Skip to Content
Merck
All Photos(3)

Key Documents

SAB1403268

Sigma-Aldrich

Monoclonal Anti-SPA17 antibody produced in mouse

clone 3B6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

SP17, SP17-1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3B6, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SPA17(53340)

General description

Sperm autoantigenic protein 17 (SPA17) gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. SPA17 gene is located on human chromosome 11q24.2. This antigenic protein contains 151 amino acids and has a molecular weight of 17.4 kDa. This protein is highly expressed in testis and in somatic tissues.

Immunogen

SPA17 (NP_059121, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE

Biochem/physiol Actions

Sperm autoantigenic protein 17 (SPA17) functions as a testis specific antigen. It also mediates signal transduction, protein synthesis and unregulated growth in proliferating and neoplastic cells. Overexpression of this protein decreases the resistance of epithelial ovarian carcinoma to chemotherapy. It regulates protein kinase A-independent AKAP (A-kinase anchoring proteins) complex in both germinal and somatic cells.160 The gene is associated with rheumatoid arthritis (RA).

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Overexpression of human sperm protein 17 increases migration and decreases the chemosensitivity of human epithelial ovarian cancer cells
Li FQ, et al.
BMC Cancer, 9(1), 323-323 (2009)
SPA17 (sperm autoantigenic protein 17)
Faried LS and Farie A
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2008)
Differentially expressed genes in the prostate cancer cell line LNCaP after exposure to androgen and anti-androgen
Coutinho-Camillo CM, ET AL.
Cancer Genetics and Cytogenetics, 166(2), 130-138 (2006)
Sperm protein 17 is expressed in the sperm fibrous sheath
Chiriva-Internati M, et al.
Journal of Translational Medicine, 7(1), 61-61 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service