SAB1403197

Monoclonal Anti-GNMT, (N-terminal) antibody produced in mouse

clone 2B10, ascites fluid

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 2B10, monoclonal
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgMκ
• NCBI accession no.: NM_018960
• UniProt accession no.: Q14749
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GNMT(27232)

Description

General description

The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. The encoded protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). (provided by RefSeq)

Immunogen

GNMT (NP_061833.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERW

Physical form

Clear solution

Safety Information

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable