콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

WH0009075M1

Sigma-Aldrich

Monoclonal Anti-CLDN2 antibody produced in mouse

clone 3F1, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-claudin 2

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

3F1, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG2aκ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CLDN2(9075)

일반 설명

Claudin-2 (CLDN2) is one of the pore-forming claudins and is a member of the claudin family of proteins. It is present in the proximal tubules and the gene encoding it is localized on human chromosome Xq22.

면역원

CLDN2 (NP_065117, 29 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA

생화학적/생리학적 작용

Claudin-2 (CLDN2) controls paracellular permeability and maintains cell polarity in epithelial and endothelial cell sheets. In MDCK (madin-darby canine kidney cells), claudin-2 participates in the generation of aqueous pores with high conductance.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Inhibition of Autophagic Degradation Process Contributes to Claudin-2 Expression Increase and Epithelial Tight Junction Dysfunction in TNF-a Treated Cell Monolayers
Cong Zhang
International Journal of Molecular Sciences (2017)
Tumor necrosis factor-a induces a biphasic change in claudin-2 expression in tubular epithelial cells: role in barrier functions
Yasaman Amoozadeh
American Journal of Physiology. Cell Physiology (2015)
Conversion of Zonulae Occludentes from Tight to Leaky Strand Type by Introducing Claudin-2 into Madin-Darby Canine Kidney I Cells
Mikio Furuse
The Journal of Biological Chemistry (2001)
The claudins
Madhu Lal-Nag and Patrice J Morin
Genome Biology (2009)
Ágnes Holczbauer et al.
Pathology oncology research : POR, 20(3), 493-502 (2014-04-04)
Claudins have been reported to be differentially regulated in malignancies and implicated in the process of carcinogenesis and tumor progression. Claudin-1 has been described as key factor in the entry of hepatitis C virus (HCV) into hepatocytes and as promoter

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.