추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
1A1, monoclonal
양식
buffered aqueous solution
종 반응성
human
기술
ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL
동형
IgG1κ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TOP1(7150)
일반 설명
The gene TOP1 (DNA topoisomerase 1) is mapped to human chromosome 20q12-q13.1. The protein localizes in the nucleus.
면역원
TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Sequence
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
생화학적/생리학적 작용
DNA topoisomerases cause single (type-1) or double (type-2) strand DNA breaks, leading to DNA relaxation. They control DNA replication, transcription, recombination and chromatin remodeling. TOP1 (DNA topoisomerase 1) binds to the promoters and thereby induces nucleosome disassembly, histone acetylation and gene expression. Camptothecin is a non-competitive TOP1 inhibitor. TOP1 also controls alternative splicing through phosphorylation of serine/arginine-rich proteins. It is up-regulated in non-small cell lung cancer (NSCLC).
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Rhythmic binding of Topoisomerase I impacts on the transcription of Bmal1 and circadian period.
Yoshiaki Onishi
Nucleic Acids Research, 40 (2012)
Correlation between topoisomerase I and tyrosyl-DNA phosphodiesterase 1 activities in non-small cell lung cancer tissue
Ann-Katrine Jakobsen
Experimental and Molecular Pathology, 99 (2015)
Sumoylation of topoisomerase I is involved in its partitioning between nucleoli and nucleoplasm and its clearing from nucleoli in response to camptothecin
Prasad Rallabhandi
The Journal of Biological Chemistry, 27 (2002)
Salim Khiati et al.
Molecular pharmacology, 86(2), 193-199 (2014-06-04)
Lamellarin D (Lam-D) is a hexacyclic pyrole alkaloid isolated from marine invertebrates, whose biologic properties have been attributed to mitochondrial targeting. Mitochondria contain their own DNA (mtDNA), and the only specific mitochondrial topoisomerase in vertebrates is mitochondrial topoisomerase I (Top1mt).
Elevated expression levels of NCOA3, TOP1, and TFAP2C in breast tumors as predictors of poor prognosis
Chen Zhao
Cancer, 98 (2003)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.