WH0007137M4

Monoclonal Anti-TNNI3 antibody produced in mouse

clone 1E7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CMH7, Anti-MGC116817, Anti-TNNC1, Anti-cTnI, Anti-troponin I type 3 (cardiac)
• MDL number: MFCD01864286
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1E7, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_000363
• UniProt 수납 번호: P19429
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TNNI3(7137)

설명

일반 설명

Troponin I3, cardiac type (TNNI3), also known as cardiac troponin I (cTnI), is the inhibitory element of troponin. It possesses an inhibitory peptide (IP) domain and a switch peptide (SP) domain that is located N-terminal of the IP domain. The gene encoding TNNI3 is localized on human chromosome 19q13.42.

면역원

TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES

생화학적/생리학적 작용

Troponin I3, cardiac type (TNNI3) or cardiac troponin I (cTnI) modulates the diastolic function of the heart. Low expression of TNNI3 is associated with cardiac diastolic dysfunction. Elevated expression of the protein indicates cardiac injury. TNNI3 is a biomarker for myocardial infarction and mutations in the gene encoding it have been linked to hypertrophic cardiomyopathy.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)