추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
6G8, monoclonal
양식
buffered aqueous solution
종 반응성
human, rat, mouse
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CITED1(4435)
일반 설명
CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) is a non-DNA binding transcriptional co-activator. It has a smad-4 interacting domain (SID) and a conserved region 2 (CR2) domain. This gene codes for a 27 kDa protein that belongs to the CITED (CBP/p300-interacting transactivators with glutamic acid [E] and aspartic acid [D]-rich C-terminal domain) family of nuclear proteins. CITED1 is located on human chromosome Xq13.
This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. (provided by RefSeq)
면역원
CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
생화학적/생리학적 작용
CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) controls cellular activities of the metanephric mesenchyme. This gene is linked to papillary thyroid carcinoma. MSG1 is involved in pigmentation. It also participates in malignant transformation of pigment cells.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Galectin-3, fibronectin-1, CITED-1, HBME1 and cytokeratin-19 immunohistochemistry is useful for the differential diagnosis of thyroid tumors
Prasad ML, et al.
Modern Pathology, 18(1), 48-57 (2005)
Aberrant expression of MSG1 transcriptional activator in human malignant melanoma in vivo
Ahmed NU, et al.
Pigment Cell Research / Sponsored by the European Society for Pigment Cell Research and the International Pigment Cell Society, 14(2), 140-143 (2001)
Wilms' tumorigenesis is altered by misexpression of the transcriptional co-activator, CITED1
Lovvorn HN 3rd, et al.
Journal of Pediatric Surgery, 42(3), 474-481 (2007)
Establishment and genetic characterization of a novel mixed-phenotype acute leukemia cell line with EP300-ZNF384 fusion
Ping N, et al.
Journal of Hematology & Oncology (2015)
Establishment and genetic characterization of a novel mixed-phenotype acute leukemia cell line with EP300-ZNF384 fusion
Ping N, et al.
Journal of Hematology & Oncology, 8(1), 100-100 (2015)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.