SAB5702697

Anti-AHA1 Antibody, clone 8E5H7, Rabbit Monoclonal

• 동의어(들): AHA1, C14orf3, hAha1, p38
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 8E5H7, monoclonal
• 양식: liquid
• 분자량: 42 kDa
• 종 반응성: human, rat, rat
• 농도: 0.58 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: PATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF
• UniProt 수납 번호: O95433
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... AHSA1(10598)

설명

일반 설명

AHA-1 stimulates the inherent ATPase activity of yeast and human HSP 90 and interacts with the cytoplasmic tail of vesticular stomatitis virus glycoprotein. AHA-1 regulates HSP 90 by influencing the conformational state of the “ATP lid” and consequent N-terminal dimerization. It is crucial for cell viability under non-optimal growth conditions when HSP 90 levels are limiting. AHA-1 is a cytosolic protein and may transiently interact with the endoplasmic reticulum. It can have an affect on one step in the endoplasmic to Golgi trafficking. AHA-1 is expressed in numerous tissues, including brain, heart, skeletal muscle and kidney and, at lower levels, in liver and placenta. It is induced by heat shock and treatment with the HSP 90 inhibitor 17-demeth-oxygeldanamycin.

면역원

A synthetic peptide corresponding to a sequence within amino acids 239-338 of human AHA1 (O95433).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1