생물학적 소스
mouse
Quality Level
결합
Atto 390 conjugate
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
S319A-14, monoclonal
양식
buffered aqueous solution
분자량
antigen predicted mol wt 120 kDa
종 반응성
rat, mouse
농도
1 mg/mL
기술
immunocytochemistry: suitable
immunohistochemistry: suitable
western blot: suitable
동형
IgG2a
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
mouse ... Abcc9(20928)
면역원
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
특징 및 장점
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
물리적 형태
PBS pH7.4, 50% glycerol, 0.09% sodium azide
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Nanoscale organization of nicotinic aceylcholine receptors by stimulated emission depletion microscopy.
Neuroscience, 144(1), 135-143 (2007)
Stimulated emission depletion-based raster image correlation spectroscopy reveals biomolecular dynamics in live cells.
Hedde P.N.; et al.
Nature Communications, 4, 2093-2093 (2013)
Munc18-1 Tuning of Vesicle Merger and Fusion Pore Properties.
Jorgacevski, J.; et al.
The Journal of Neuroscience, 31(24), 9055-9066 (2011)
SNARE Function Is Not Involved in Early Endosome Docking.
Geumann, U.; et al.
Molecular Biology of the Cell, 19(12), 5327-5337 (2008)
STED Nanoscopy in Living Cells Using Fluorogen Activating Proteins.
Fitzpatrick, JA.; et al.
Bioconjugate Chemistry, 20(10), 1843-1847 (2009)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.