추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
38 kDa
종 반응성
mouse, human, guinea pig, dog, rat
농도
0.5-1 mg/mL
기술
immunoblotting: suitable
수납 번호(accession number)
NM_003049
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SLC10A1(6554)
일반 설명
The gene SLC10A1 (solute carrier family 10 member 1) is mapped to human chromosome 14q24.2. It is mainly expressed in the liver cells.
면역원
Synthetic peptide directed towards the middle region of human SLC10A1
생화학적/생리학적 작용
SLC10A1 (solute carrier family 10 member 1) is a bile acid transporter. It plays an important role in the circulation of bile acids. Mutation in this gene is associated with hypercholanemia. SLC10A1 also plays an important role in the entry of HBV (Hepatitis B virus) and silencing of this gene inhibits HBV infection. It works as a receptor for preS1 domain in HBV.
서열
Synthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Clinical and molecular study of a pediatric patient with sodium taurocholate cotransporting polypeptide deficiency.
Deng M, et al.
Experimental and Therapeutic Medicine, 12, 3294-3300 (2016)
Hepatitis B virus efficiently infects non-adherent hepatoma cells via human sodium taurocholate cotransporting polypeptide.
Okuyama-Dobashi K, et al.
Scientific Reports, 5, 17047-17047 (2015)
A genetic variant of the NTCP gene is associated with HBV infection status in a Chinese population.
Yang J, et al.
BMC Cancer, 16, 211-211 (2016)
The nuclear receptor FXR, but not LXR, up-regulates bile acid transporter expression in non-alcoholic fatty liver disease.
Aguilar-Olivos NE, et al.
Annals of Hepatology, 14, 487-493 (2015)
Fatemeh Alaei Faradonbeh et al.
Frontiers in physiology, 13, 859294-859294 (2022-04-08)
Multidrug resistance-associated protein 2 (Mrp2) mediates biliary secretion of anionic endobiotics and xenobiotics. Genetic alteration of Mrp2 leads to conjugated hyperbilirubinemia and predisposes to the development of intrahepatic cholestasis of pregnancy (ICP), characterized by increased plasma bile acids (BAs) due
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.