생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
63 kDa
종 반응성
human, guinea pig, dog, bovine
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... IGF2BP3(10643)
면역원
Synthetic peptide directed towards the middle region of human IGF2BP3
생화학적/생리학적 작용
Igf2bp3 is a RNA-binding protein that act as a regulator of mRNA translation and stability. Igf2bp3 binds to the 5′-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Igf2bp3 binds to sequences in the 3′-UTR of CD44 mRNA.
서열
Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
K Yoshino et al.
Diseases of the esophagus : official journal of the International Society for Diseases of the Esophagus, 27(5), 479-484 (2012-09-20)
Identification of reliable markers of radiosensitivity and the key molecules that donate susceptibility to anticancer treatments to esophageal cancer cells would be highly desirable. We found that the mRNA expression of insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3) was higher
Kazuki Takahashi et al.
Biochemical and biophysical research communications, 448(1), 22-27 (2014-04-17)
In immature zebrafish oocytes, dormant cyclin B1 mRNAs localize to the animal polar cytoplasm as aggregates. After hormonal stimulation, cyclin B1 mRNAs are dispersed and translationally activated, which are necessary and sufficient for the induction of zebrafish oocyte maturation. Besides
Emanuel Adelino M Damasceno et al.
Journal of cancer research and clinical oncology, 140(12), 2163-2168 (2014-10-18)
The aim of this study was to evaluate the expression of IMP3, an independent poor prognostic factor for many cancers, and its association with clinicopathological features and HER2 status. Gastrectomy specimens from 106 patients were evaluated by immunohistochemistry and fluorescence
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.