SAB2105568

Anti-SRD5A2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-MGC138457
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 28 kDa
• 종 반응성: bovine, horse, dog, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NM_000348
• UniProt 수납 번호: P31213
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SRD5A2(6716)

설명

일반 설명

Steroid 5α-reductase type 2 (SRD5A2) enzyme is expressed in the male reproductory system and contains an N-terminal testosterone-binding domain and a C-terminal nicotinamide adenine dinucleotide phosphate (NADPH)-binding domain. The SRD5A2 gene is mapped on the human chromosome at 2p23.1.

면역원

Synthetic peptide directed towards the N terminal region of human SRD5A2

생화학적/생리학적 작용

Steroid 5α-reductase type 2 (SRD5A2) enzyme mediates the conversion of testosterone to dihydrotestosterone (DHT). Mutations in the SRD5A2 gene are associated with an autosomal recessive form of 46, XY differences disorders of sexual development (DSD) in males characterized by underdeveloped and atypical genitalia. Overexpression of the SRD5A2 gene is associated with androgenic alopecia, benign prostatic hyperplasia (BPH), and prostate cancer. This gene is expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudo-hermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

서열

Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable