콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

SAB2104467

Sigma-Aldrich

Anti-ETV1 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-DKFZp781L0674, Anti-ER81, Anti-MGC104699, Anti-MGC120533, Anti-MGC120534

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

55 kDa

종 반응성

dog, horse, mouse, guinea pig, human, rat, bovine

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ETV1(2115)

일반 설명

Ets variant gene 1 (ETV1) is a novel androgen-regulated gene mapped to human chromosome 7p21.2. ETV1 protein belongs to the E-twenty-six (ETS) transcription factor family and it contains the ETS domain and acidic transactivation domain. ETV1 binds to DNA sequences containing the consensus pentanucleotide 5′-CGGA[AT]-3′.

면역원

Synthetic peptide directed towards the middle region of human ETV1

애플리케이션

Anti-ETV1 antibody produced in rabbit has been used in western blot(1:500)

생화학적/생리학적 작용

E-twenty-six (ETS) proteins participate in cell proliferation and cancer cell invasion. Ets variant gene 1 (ETV1) acts as a neuregulin-1 (NRG1) responsive factor and is important for establishing rapid conduction physiology in the heart. Overexpression of the gene has been observed in various types of cancers including prostate cancer and gastrointestinal stromal tumors

서열

Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Ping Chi et al.
Nature, 467(7317), 849-853 (2010-10-12)
Gastrointestinal stromal tumour (GIST) is the most common human sarcoma and is primarily defined by activating mutations in the KIT or PDGFRA receptor tyrosine kinases. KIT is highly expressed in interstitial cells of Cajal (ICCs)-the presumed cell of origin for
ETV1 is a novel androgen receptor-regulated gene that mediates prostate cancer cell invasion.
Cai, et al.
Molecular Endocrinology, 21, 1835-1846 (2013)
Xiao Song et al.
Cancer research, 79(20), 5288-5301 (2019-08-30)
Misregulated alternative RNA splicing (AS) contributes to the tumorigenesis and progression of human cancers, including glioblastoma (GBM). Here, we showed that a major splicing factor, serine and arginine rich splicing factor 3 (SRSF3), was frequently upregulated in clinical glioma specimens
La Ta et al.
Molecular medicine reports, 14(2), 1371-1378 (2016-06-10)
Constitutive photomorphogenic 1 (COP1) belongs to the COP‑de-etiolated (DET)‑fusca (FUS) protein family and has been demonstrated to suppress prostate adenocarcinomas and other types of tumor, such as liver and gastric cancer. The present study investigated the expression of COP1 and its
Sangphil Oh et al.
Scientific reports, 9(1), 8186-8186 (2019-06-05)
The ETS transcription factor ETV1 is frequently overexpressed in aggressive prostate cancer, which is one underlying cause of this disease. Accordingly, transgenic mice that prostate-specifically overexpress ETV1 develop prostatic intraepithelial neoplasia. However, progression to the adenocarcinoma stage is stifled in

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.