추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
55 kDa
종 반응성
dog, horse, mouse, guinea pig, human, rat, bovine
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ETV1(2115)
일반 설명
Ets variant gene 1 (ETV1) is a novel androgen-regulated gene mapped to human chromosome 7p21.2. ETV1 protein belongs to the E-twenty-six (ETS) transcription factor family and it contains the ETS domain and acidic transactivation domain. ETV1 binds to DNA sequences containing the consensus pentanucleotide 5′-CGGA[AT]-3′.
면역원
Synthetic peptide directed towards the middle region of human ETV1
애플리케이션
Anti-ETV1 antibody produced in rabbit has been used in western blot(1:500)
생화학적/생리학적 작용
E-twenty-six (ETS) proteins participate in cell proliferation and cancer cell invasion. Ets variant gene 1 (ETV1) acts as a neuregulin-1 (NRG1) responsive factor and is important for establishing rapid conduction physiology in the heart. Overexpression of the gene has been observed in various types of cancers including prostate cancer and gastrointestinal stromal tumors
서열
Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Ping Chi et al.
Nature, 467(7317), 849-853 (2010-10-12)
Gastrointestinal stromal tumour (GIST) is the most common human sarcoma and is primarily defined by activating mutations in the KIT or PDGFRA receptor tyrosine kinases. KIT is highly expressed in interstitial cells of Cajal (ICCs)-the presumed cell of origin for
ETV1 is a novel androgen receptor-regulated gene that mediates prostate cancer cell invasion.
Cai, et al.
Molecular Endocrinology, 21, 1835-1846 (2013)
Xiao Song et al.
Cancer research, 79(20), 5288-5301 (2019-08-30)
Misregulated alternative RNA splicing (AS) contributes to the tumorigenesis and progression of human cancers, including glioblastoma (GBM). Here, we showed that a major splicing factor, serine and arginine rich splicing factor 3 (SRSF3), was frequently upregulated in clinical glioma specimens
La Ta et al.
Molecular medicine reports, 14(2), 1371-1378 (2016-06-10)
Constitutive photomorphogenic 1 (COP1) belongs to the COP‑de-etiolated (DET)‑fusca (FUS) protein family and has been demonstrated to suppress prostate adenocarcinomas and other types of tumor, such as liver and gastric cancer. The present study investigated the expression of COP1 and its
Sangphil Oh et al.
Scientific reports, 9(1), 8186-8186 (2019-06-05)
The ETS transcription factor ETV1 is frequently overexpressed in aggressive prostate cancer, which is one underlying cause of this disease. Accordingly, transgenic mice that prostate-specifically overexpress ETV1 develop prostatic intraepithelial neoplasia. However, progression to the adenocarcinoma stage is stifled in
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.