추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
64 kDa
종 반응성
human, rabbit, rat, guinea pig, bovine, mouse, dog, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SLC24A6(80024)
일반 설명
Solute carrier family 24, member 6 (SLC24A6) or solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 (SLC8B1) gene codes for Na+/Ca2+/Li+ exchanger (NCLX). NCLX belongs to the Na+/Ca2+ exchanger (NCX) family. This protein is expressed at a high level in the brain, skeletal and heart muscle, pancreas β-cells, and lymphocyte B-cells. NCLX contains a small regulatory domain that has a phosphorylation site and lacks Ca2+ binding domains (CBDs).
면역원
Synthetic peptide directed towards the middle region of human SLC24A6
애플리케이션
Anti-SLC24A6 antibody produced in rabbit has been used in western blotting(1:250).
생화학적/생리학적 작용
Solute carrier family 8, member B1 (SLC8B1)/Na+/Ca2+/Li+ exchanger (NCLX) helps in the transportation of the sodium or lithium-ion in exchange for the calcium ion.
서열
Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Marko Kostic et al.
Seminars in cell & developmental biology, 94, 59-65 (2019-01-19)
Mitochondrial Ca2+ transient is the earliest discovered organellar Ca2+ signaling pathway. It consist of a Ca2+ influx, mediated by mitochondrial Ca2+ uniporter (MCU), and mitochondrial Ca2+ efflux mediated by a Na+/Ca2+ exchanger (NCLX). Mitochondrial Ca2+ signaling machinery plays a fundamental
Marko Kostic et al.
Cell reports, 25(12), 3465-3475 (2018-12-20)
Calcium is a key regulator of mitochondrial function under both normal and pathological conditions. The mechanisms linking metabolic activity to mitochondrial Ca2+ signaling remain elusive, however. Here, by monitoring mitochondrial Ca2+ transients while manipulating mitochondrial membrane potential (ΔΨm), we found
Olha M Koval et al.
Science signaling, 12(579) (2019-05-02)
The role of the mitochondrial Ca2+ uniporter (MCU) in physiologic cell proliferation remains to be defined. Here, we demonstrated that the MCU was required to match mitochondrial function to metabolic demands during the cell cycle. During the G1-S transition (the
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.