추천 제품
제품명
Anti-FOS antibody produced in rabbit, affinity isolated antibody
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
41 kDa
종 반응성
sheep, dog, human, mouse, bovine, rat, pig
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... FOS(2353)
면역원
Synthetic peptide directed towards the N terminal region of human FOS
서열
Synthetic peptide located within the following region: MFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCT
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Nelly Boyer et al.
Pain, 155(7), 1196-1205 (2014-03-19)
Migraine is a chronic disease with episodic manifestations. In a subgroup, attack frequency increases over time, leading to chronic migraine. One of the most important risk factors for migraine progression is frequency of headache attacks at baseline. Unfortunately, the actual
Andrew Ralya et al.
Neuroscience letters, 575, 91-95 (2014-05-28)
Chronic pain is a major neurological disorder that can manifest differently between genders or sexes. The complex actions of sex hormones may underlie these differences; previous studies have suggested that elevated estrogen levels can enhance pain perception. The purpose of
Joyce Besheer et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 39(10), 2376-2386 (2014-04-10)
Escalations in alcohol drinking associated with experiencing stressful life events and chronic life stressors may be related to altered sensitivity to the interoceptive/subjective effects of alcohol. Indeed, through the use of drug discrimination methods, rats show decreased sensitivity to the
Brian Kinsman et al.
American journal of physiology. Regulatory, integrative and comparative physiology, 307(9), R1092-R1100 (2014-08-08)
Recent studies suggest the ability of the central nervous system to detect changes in osmolality is mediated by products of the genes encoding the transient receptor potential vanilloid-1 (TRPV1) or vanilloid-4 (TRPV4) channel. The purpose of the present study was
Carli J Smith et al.
American journal of physiology. Gastrointestinal and liver physiology, 307(8), G793-G802 (2014-09-06)
The gut-brain-microbiota axis is increasingly recognized as an important regulator of intestinal physiology. Exposure to psychological stress causes activation of the hypothalamic-pituitary-adrenal (HPA) axis and causes altered intestinal barrier function, intestinal dysbiosis, and behavioral changes. The primary aim of this
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.