추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2A9, monoclonal
양식
buffered aqueous solution
분자량
antigen 35.09 kDa
종 반응성
human
기술
indirect ELISA: suitable
indirect immunofluorescence: suitable
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MUC2(4583)
일반 설명
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)
면역원
MUC2 (NP_002448, 4993 a.a. ~ 5078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
THCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTV
Sequence
THCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTV
물리적 형태
Solution in phosphate buffered saline, pH 7.4
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
Tsukasa Nishida et al.
Diseases of the colon and rectum, 57(8), 905-915 (2014-07-09)
The appropriateness of endoscopic resection in patients with T1 colorectal carcinomas is unclear. Highly precise predictors of lymph node metastasis are required to optimize the outcomes of treatments for T1 colorectal carcinomas. The purpose of this work was to identify
Takanori Yamada et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 70, 107-113 (2014-05-20)
Helicobacter pylori (H. pylori) infection is well known to be associated with chronic gastritis and also development of gastric cancer. Raphanobrassica (RB) is an intergeneric hybrid of the genera Raphanus (radish) and Brassica (cabbages) containing appreciable amounts of glucoraphanin (GR)
Øystein Sørdal et al.
Experimental and molecular pathology, 96(3), 274-278 (2014-03-05)
The purpose of this study is to assess the exocrine and neuroendocrine properties of tumour cells in diffuse gastric cancer with signet ring cell differentiation. Mucin mRNA and protein expressions (MUC1, 2, 3, 4, 5AC, 6 and MUC13) were assessed
Stéphanie Da Silva et al.
American journal of physiology. Gastrointestinal and liver physiology, 307(4), G420-G429 (2014-06-28)
Despite well-known intestinal epithelial barrier impairment and visceral hypersensitivity in irritable bowel syndrome (IBS) patients and IBS-like models, structural and physical changes in the mucus layer remain poorly understood. Using a water avoidance stress (WAS) model, we aimed at evaluating
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.