콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

SAB1409921

Sigma-Aldrich

Anti-LY6D antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

동의어(들):

E48

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

antigen 13.3 kDa

종 반응성

human

기술

western blot: 1 μg/mL

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... LY6D(8581)

일반 설명

The gene LY6D (lymphocyte antigen 6 complex, locus D) is mapped to human chromosome 8q24.3. It belongs to the LY6 (lymphocyte antigen 6) gene family. The encoded protein is a membrane protein with molecular weight of 14kDa. It is a glycosyl phosphatidylinositol (GPI)-anchored protein.

면역원

LY6D (NP_003686.1, 1 a.a. ~ 128 a.a) full-length human protein.

Sequence
MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL

생화학적/생리학적 작용

LY6D (lymphocyte antigen 6 complex, locus D) is required for discriminating B lineage restricted common lymphoid progenitors. It is upregulated by X-ray irradiation-mediated DNA damage pathway controlled via ATM (ataxia telangiectasia mutated), CHK2 (checkpoint kinase 2) and p53. LY6D is upregulated in various cancers and is associated with patient survival outcome.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Jie Hu et al.
American journal of medical genetics. Part A, 167A(8), 1921-1926 (2015-04-14)
A 7-year-old female with developmental delay (DD), autism spectrum disorder (ASD), intellectual disability (ID), attention deficit hyperactivity disorder (ADHD), and seizures was referred to our laboratory for oligomicroarray analysis. The analysis revealed a 540 kb microdeletion in the chromosome 8q24.3 region
Qingzhao Zhang et al.
PloS one, 8(8), e72397-e72397 (2013-09-12)
Common lymphoid progenitors (CLPs) are thought to represent major intermediates in the transition of hematopoietic stem cells (HSCs) to B lineage lymphocytes. However, it has been obvious for some time that CLPs are heterogeneous, and there has been controversy concerning
Linlin Luo et al.
Oncotarget, 7(10), 11165-11193 (2016-02-11)
Stem cell antigen-1 (Sca-1) is used to isolate and characterize tumor initiating cell populations from tumors of various murine models [1]. Sca-1 induced disruption of TGF-β signaling is required in vivo tumorigenesis in breast cancer models [2, 3-5]. The role
Maiko Kurosawa et al.
The FEBS journal, 279(24), 4479-4491 (2012-10-19)
In order to identify membrane proteins whose expression is induced by X-ray irradiation, we developed an antibody (Ab)-directed strategy using a phage Ab library. X-Ray-irradiated cells were screened with a phage Ab library in the presence of a large excess

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.