추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2F1, monoclonal
양식
buffered aqueous solution
분자량
antigen ~37.11 kDa
종 반응성
human
기술
capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CTLA4(1493)
일반 설명
The CTLA4 (cytotoxic T lymphocyte associated-4) gene is mapped to human chromosome 2q33. It is a glycoprotein found on T-cells and is homologous to CD28 (Cluster of Differentiation 28) at the juxtamembrane and cytoplasmic regions.
면역원
CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY
Sequence
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY
생화학적/생리학적 작용
The CTLA4 (cytotoxic T lymphocyte associated-4) gene encodes a membrane receptor on cytotoxic T-cells that functions in T-cell apoptosis. It is a strong inhibitor of T-cell activation. It may be associated with type 1 diabetes. The gene has been identified as a susceptibility locus for Graves′ disease. It may be involved in the pathogenesis of autoimmune disorders.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
The CTLA-4 gene region of chromosome 2q33 is linked to, and associated with, type 1 diabetes.
Nistico L, et al.
Human Molecular Genetics, 5(7), 1075-1080 (1996)
CTLA-4 is a second receptor for the B cell activation antigen B7.
Linsley P S, et al.
The Journal of Experimental Medicine, 174(3), 561-569 (1991)
The development of Graves? disease and the CTLA-4 gene on chromosome 2q33.
Heward J M, et al.
The Journal of Clinical Endocrinology and Metabolism, 84(7), 2398-2401 (1999)
Daniele Saverino et al.
PloS one, 9(11), e112509-e112509 (2014-11-11)
Primary biliary cirrhosis (PBC) is a chronic autoimmune cholestatic liver disease frequently characterized by anti-mitochondrial autoantibodies (AMA). A minority of patients are AMA-negative. Cytotoxic-T-Lymphocyte-Antigen-4 (CTLA-4) is a surface molecule expressed on activated T-cells delivering a critical negative immunoregulatory signal. A
Sigrid Regauer et al.
Histology and histopathology, 29(8), 1017-1025 (2014-01-10)
Introduction. Lichen planus (LP) is a chronic cytokine-mediated disease of possible auto-immune etiology. 25% of men have anogenital manifestations. Erosive penile LP causes a scarring phimosis of the foreskin in uncircumcised men. Mast cells as potent immune modulators have been
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.