SAB1403138

Monoclonal Anti-SLC7A8, (C-terminal) antibody produced in mouse

clone 3F10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): LAT2, LPI-PC1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3F10, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~33.7 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_012244
• UniProt 수납 번호: Q9UHI5
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC7A8(23428)

설명

일반 설명

Solute carrier family 7 member 8 (SLC7A8), also known as L-amino acid transporter-2 (LAT-2), is part of the amino acid transporters family. It is a subunit of the heavy chain of the surface antigen 4F2 (4F2hc). The protein is expressed in the placenta and fetal capillaries. The SLC7A8 gene is localized on human chromosome 14q11.2.

면역원

SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

생화학적/생리학적 작용

Solute carrier family 7 member 8 (SLC7A8) is involved in amino acid transport.It has a role in absorption of neutral amino acids in the kidney. Mutations in the gene encoding this protein have been linked to lysinuric protein intolerance.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable