추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3A6, monoclonal
양식
buffered aqueous solution
분자량
antigen ~38.1 kDa
종 반응성
human
기술
capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG1κ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SLC5A3(6526)
일반 설명
Solute carrier family 5 member 3 (SLC5A3) is a member of SLC5A gene family, which shares five transmembrane segment inverted repeats of the LeuT structural family. SLC5A3 is expressed in brain, kidney and placenta. SLC5A3 gene is located on human chromosome 21q22.11.
면역원
SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE
Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE
애플리케이션
Monoclonal Anti-SLC5A3 antibody produced in mouse has been used in dSTORM (direct stochastic optical reconstruction microscopy).
생화학적/생리학적 작용
Solute carrier family 5 member 3 (SLC5A3) functions in cellular osmoregulation. Overexpression of SLC5A3 contributes to pathophysiology of Down syndrome. SLC5A3 acts as a transporter in hypotonic volume regulation of mammalian cells. SLC5A3 regulates millimolar intracellular concentrations of myo-inositol and promotes transepithelial myo-inositol transport in kidney, intestine, retina and choroid plexus.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
The transport mechanism of the human sodium/myo-inositol transporter 2 (SMIT2/SGLT6), a member of the LeuT structural family
Sasseville L, et al.
American Journal of Physiology. Cell Physiology, 307(5) (2014)
The structural organization of the human Na+/myo-inositol cotransporter (SLC5A3) gene and characterization of the promoter
Mallee J, et al.
Genomics, 46(3) (1997)
Human Na+-myo-inositol cotransporter gene: alternate splicing generates diverse transcripts
Porcellati F, et al.
American Journal of Physiology. Cell Physiology, 274(5) (1998)
Replication of relevant SNPs associated with cardiovascular disease susceptibility obtained from GWAs in a case-control study in a Canarian population
Esparragon F R , et al.
Disease Markers, 32(4) (2012)
Hypotonic activation of the myo-inositol transporter SLC5A3 in HEK293 cells probed by cell volumetry, confocal and super-resolution microscopy
Andronic J, et al.
PLoS ONE, 10(3), e0119990-e0119990 (2015)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.