콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

SAB1401873

Sigma-Aldrich

Anti-INHBE antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

동의어(들):

MGC4638

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.43

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

종 반응성

mouse, human

기술

immunoprecipitation (IP): suitable
western blot: 1 μg/mL

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... INHBE(83729)

일반 설명

Inhibin subunit beta E (INHBE) is a dimeric protein, which is majorly expressed in human liver. The gene is located on human chromosome 12q13.3.

면역원

INHBE (NP_113667.1, 1 a.a. ~ 350 a.a) full-length human protein.

Sequence
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

생화학적/생리학적 작용

Inhibin subunit beta E (INHBE) may be associated with carcinogenesis. Differential expression of INHBE in human endometrial tissue plays an important role in endometrial maturation and blastocyst implantation. The protein is a hepatokine linked to hepatic gene expression. It is associated with insulin resistance and body mass index in humans. The protein expression in liver is stimulated by insulin. It is involved in glucose metabolism.

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our 문서 section.

도움이 필요하시면 연락하세요. 고객 지원 부서

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Evidence of inhibin/activin subunit betaC and betaE synthesis in normal human endometrial tissue
Mylonas L and Br
Reproductive Biology and Endocrinology, 8(1), 143-143 (2010)
Inhibin betaE (INHBE) is a possible insulin resistance-associated hepatokine identified by comprehensive gene expression analysis in human liver biopsy samples
Sugiyama M, et al.
PLoS ONE, 13(3), e0194798-e0194798 (2018)
An insight into the phylogenetic history of HOX linked gene families in vertebrates
Abbasi AA, et al.
BMC Evolutionary Biology, 7(1), 239-239 (2007)
cDNA cloning and expression of human activin betaE subunit
Hashimoto O, et al.
Molecular and Cellular Endocrinology, 194(1-2), 117-122 (2002)
Florian Bergauer et al.
Journal of molecular histology, 40(5-6), 353-359 (2009-12-25)
Inhibins are dimeric glycoproteins, composed of an alpha-subunit and one of two possible beta-subunits (betaA or betaB), with substantial roles in human reproduction and in endocrine-responsive tumours. Recently a novel beta subunit named betaE was described, although it is still

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.