콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

SAB1400142

Sigma-Aldrich

Monoclonal Anti-IL15 antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-IL15, Anti-MGC9721

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

1G3, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable

동형

IgG2bκ

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... IL15(3600)

일반 설명

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other′s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. (provided by RefSeq)

면역원

IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.

Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

생화학적/생리학적 작용

Interleukin-15 (IL-15) stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. It exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. On binding to its receptor, IL-15 is indirectly involved in activating proto-oncogenes. Increased expression of IL-15 has been implicated with rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis and diseases affiliated with retroviruses like human immunodeficiency virus (HIV) and human T-lymphotropic virus-1 (HTLV-I).

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Chromosomal assignment and genomic structure of Il15.
Anderson DM
Genomics, 25(3), 701-706 (1995)
Anjali Mishra et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 20(8), 2044-2050 (2014-04-17)
Interleukin-15 (IL-15) is a proinflammatory cytokine involved in the development, survival, proliferation, and activation of multiple lymphocyte lineages utilizing a variety of signaling pathways. IL-15 utilizes three distinct receptor chains in at least two different combinations to signal and exert
Yan Xia et al.
Journal of immunotherapy (Hagerstown, Md. : 1997), 37(5), 257-266 (2014-05-09)
Tumor-targeted cytokines are a new class of pharmaceutical anticancer agents often considered superior to the corresponding unconjugated cytokines for therapeutic purposes. We generated a new fusion protein, dsNKG2D-IL-15, in which double NKG2D extracellular domains were fused to IL-15, in Escherichia
Patricia K A Mongini et al.
Journal of immunology (Baltimore, Md. : 1950), 195(3), 901-923 (2015-07-03)
Clinical progression of B cell chronic lymphocytic leukemia (B-CLL) reflects the clone's Ag receptor (BCR) and involves stroma-dependent B-CLL growth within lymphoid tissue. Uniformly elevated expression of TLR-9, occasional MYD88 mutations, and BCR specificity for DNA or Ags physically linked
Bieke Broux et al.
Journal of immunology (Baltimore, Md. : 1950), 194(5), 2099-2109 (2015-01-27)
CD4(+)CD28(-) T cells arise through repeated antigenic stimulation and are present in diseased tissues of patients with various autoimmune disorders, including multiple sclerosis (MS). These cells are believed to have cytotoxic properties that contribute to the pathogenic damaging of the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.