콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

MSST0061

Sigma-Aldrich

SILuProt APOD, Apolipoprotein D human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

동의어(들):

Apo-D, ApoD

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
23201100
NACRES:
NA.32

재조합

expressed in HEK 293 cells

Quality Level

분석

≥95% (SDS-PAGE)

양식

lyophilized powder

효능

≥98% (Heavy amino acids incorporation efficiency by MS)

적합성

suitable for mass spectrometry (standard)

UniProt 수납 번호

배송 상태

ambient

저장 온도

−20°C

유전자 정보

human ... APOD(347)

관련 카테고리

일반 설명

SILuProt APOD is a recombinant, stable isotope-labeled human APOD which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of APOD in mass-spectrometry. SILuProt APOD is a protein of 189 amino acids (including a C-terminal polyhistidine and tag), with a calculated molecular mass of 21.8 kDa.

생화학적/생리학적 작용

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

서열

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline.

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.