MSST0043

SILu^™Prot TIMP1, Metalloproteinase inhibitor 1 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• UNSPSC 코드: 23201100
• NACRES: NA.54

속성

• 재조합: expressed in HEK 293 cells
• Quality Level: 200
• 분석: ≥98% (SDS-PAGE)
• 양식: lyophilized powder
• 효능: ≥98% Heavy amino acids incorporation efficiency by MS
• 적합성: suitable for mass spectrometry (standard)
• UniProt 수납 번호: P01033
• 저장 온도: −20°C

설명

일반 설명

SILu^™Prot TIMP1 is a recombinant, stable isotope-labeled human TIMP1 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP1 in mass-spectrometry. SILu^™Prot TIMP1 is a protein of 184 amino acids , with a calculated molecular mass of 20.7 kDa.

생화학적/생리학적 작용

TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.

서열

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline.

법적 정보

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable