MSST0039
SILu™Prot IFNG Interferon Gamma human
recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled
동의어(들):
IFNγ, IFN-gamma, IFNG mass-spectrometry standard, Immune interferon, Immuneinterferon, Interferon-gamma mass-spectrometry standard, stable isotope-labeled human IFNG
로그인조직 및 계약 가격 보기
모든 사진(1)
About This Item
UNSPSC 코드:
23201100
NACRES:
NA.12
추천 제품
생물학적 소스
human
Quality Level
재조합
expressed in HEK 293 cells
분석
≥98% (SDS-PAGE)
양식
lyophilized powder
효능
≥98% Heavy amino acids incorporation efficiency by MS
분자량
calculated mol wt 17 kDa
기술
mass spectrometry (MS): suitable
적합성
suitable for mass spectrometry (standard)
UniProt 수납 번호
저장 온도
−20°C
유전자 정보
human ... IFNG(3458)
관련 카테고리
일반 설명
Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.
면역원
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
생화학적/생리학적 작용
SILu™Prot IFNG is a recombinant, stable isotope-labeled human IFNG which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IFNG in mass-spectrometry. SILu Prot IFNG is a homodimer consisting of 138 amino acids, with a calculated molecular mass of 17 kDa.
물리적 형태
Supplied as a lyophilized powder containing phosphate buffered saline.
법적 정보
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.