추천 제품
일반 설명
SILu™ Lite AMBP is a recombinant human protein expressed in human 293 cells. It is a monomer of 204 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~23 kDa. SILu™ Lite AMBP is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
생화학적/생리학적 작용
AMBP is synthesized by the liver. Approximately half of the circulating protein is complexed to IgA. The free form of AMBP is filtered by the glomerulus and reabsorbed by proximal tubule cells. AMBP has been found to be a sensitive biomarker for proximal tubular dysfunction even in the early phase of injury when no histologic damage is observable. In addition, urinary AMBP has been proposed to be a useful marker of tubular dysfunction even in low-gestational-age preterm infants, a population at high risk for AKI (Acute Kidney Injury). Urinary AMBP is also a marker of kidney damage in type 2 diabetes.
서열
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVDYKDDDDKGHHHHHHHHGGQ
물리적 형태
Supplied as a lyophilized powder containing phosphate buffered saline.
법적 정보
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Elisa Bellei et al.
The journal of headache and pain, 16, 559-559 (2015-08-15)
Medication-overuse headache (MOH) is a chronic disorder that results from the overuse of analgesics drugs, triptans or other acute headache compounds. Although the exact mechanisms underlying MOH remain still unknown, several studies suggest that it may be associated with development
Vishal S Vaidya et al.
Annual review of pharmacology and toxicology, 48, 463-493 (2007-10-17)
Acute kidney injury (AKI) is a common condition with a high risk of death. The standard metrics used to define and monitor the progression of AKI, such as serum creatinine and blood urea nitrogen levels, are insensitive, nonspecific, and change
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.