콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

MSQC3

Sigma-Aldrich

SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human

recombinant, expressed in CHO cells

동의어(들):

Mass spectrometry standard, IgG, Mass spectrometry standard, Immunoglobulin-G, Stable isotope labelled IgG

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
23201100
NACRES:
NA.12

재조합

expressed in CHO cells

Quality Level

분석

≥90% (SDS-PAGE)

포장

vial of 100 μg (± 10% Lot-specific vial content given on certificate of analysis)

배송 상태

wet ice

저장 온도

−20°C

유사한 제품을 찾으십니까? 방문 제품 비교 안내

관련 카테고리

일반 설명

SILuMab is a recombinant, stable isotope-labeled, human monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMab is designed to be used as a universal internal standard for bioanalysis of monoclonal antibodies. Because of overlap with common sequences in the Fc region with candidate antibodies, SILuMab provides universal utility and thus eliminates the need to produce candidate-specific internal standards. SILuMab is an IgG1 antibody with lambda light chain, but contains peptide sequences common to other IgG isotypes.

애플리케이션

SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human has been used in a comparative study of automated antibody de novo sequencing.

특징 및 장점

Universal Peptide SequenceLocation
DTLMISRHeavy Chain (IgG1, IgG2, IgG3, IgG4)
FNWYVDGVEVHNAKHeavy Chain (IgG1)
VVSVLTVLHQDWLNGKHeavy Chain (IgG1, IgG3, IgG4)
NQVSLTCLVKHeavy Chain (IgG1, IgG2, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYKHeavy Chain (IgG1, IgG4)
AGVETTTPSKLight Chain (lambda)
YAASSYLSLTPEQWKLight Chain (lambda)
SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.
  • SILuMab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
  • Good agreement was observed between multiple peptides derived from the same target.
  • Label incorporation was determined to be >98% by mass spectrometry.
  • Sequence coverage was confirmed by peptide mapping.

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline

제조 메모

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled arginine and 13C6, 15N2-labeled lysine
SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides univer­sal utility, thus eliminating the need for production of candidate-specific internal standards.

재구성

SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure
  • Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
  • Add 500 μL of purified water containing 0.1% formic acid to the vial.
  • Mix the contents by gently inverting the vial a minimum of 5 times.
  • Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.

분석 메모

SILuMab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS

Target overlap areas are underlined
Qualitative
Intact heavy and light chains (FASTA file)

Quantitative
MRM settings provided (Skyline, xls)
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Qian Zhang et al.
Analytical chemistry, 86(17), 8776-8784 (2014-07-11)
Quantitation of therapeutic monoclonal antibodies (mAb) using liquid chromatography-tandem mass spectrometry (LC-MS/MS) for pharmacokinetic (PK) studies is becoming an essential complement to traditional antibody-based ligand binding assays (LBA). Here we show an automated method to perform LC-MS/MS-based quantitation, with IgG1
Sandor Schokker et al.
mAbs, 12(1), 1795492-1795492 (2020-08-04)
Given the increasing use of combination therapy with multiple monoclonal antibodies (mAbs), there is a clinical need for multiplexing assays. For the frequently co-administered anti-human epidermal growth factor receptor 2 (HER2) mAbs trastuzumab and pertuzumab, we developed a high-throughput and
Xi Qiu et al.
Bioanalysis, 10(13), 1055-1067 (2018-07-05)
Sample extraction using immuno-affinity capture coupled with LC-high-resolution mass spectrometer has recently emerged as a novel approach for the determination of concentrations of large molecules at intact level in biological matrix. In the current work, different data processing strategies for
Liyun Zhang et al.
Bioanalysis, 10(13), 1039-1054 (2018-06-29)
The requirements for developing antibody biotherapeutics benefit from understanding the nature and relevant aspects of the entire molecule. The method presented herein employs on-line multidimensional LC-quadrupole time-of-flight (QTOF)-MS for the quantitative determination of an antibody isolated from biological samples while
Automated Antibody De Novo Sequencing and Its Utility in Biopharmaceutical Discovery.
Sen K I, et al.
Journal of the American Society For Mass Spectrometry, 28(5), 803-810 (2017)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.