HPA045537

Anti-EIF4EBP3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-4E-BP3, Anti-Eukaryotic Translation Initiation Factor 4E Binding Protein 3
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA045537
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• 면역원 서열: LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM
• UniProt 수납 번호: O60516
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EIF4EBP3(8637)

설명

일반 설명

4E-BP3 (eIF4E-binding protein 3) belongs to the eukaryotic initiation factor 4E-binding protein family. It has three exons (A, B and C) and two introns. 4E-BP3 is expressed at high level in the liver than in kidney. This gene is mapped to human chromosome 5q31.3.

면역원

eukaryotic translation initiation factor 4E binding protein 3 recombinant protein epitope signature tag (PrEST)

생화학적/생리학적 작용

4E-BP3 (eIF4E-binding protein 3) modulates nuclear mRNA export, mediated by eIF4E and communicates with replication protein A2. Overexpression of 4E-BP3 decreases eIF4E-dependent translation. 4E-BP3 is a heat stable protein that has the ability to connect to eIF4E in vitro and in vivo.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST84597

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable