HPA041402
Anti-CARMIL2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-LRRC16C, Anti-RLTPR, Anti-Carmil2, Anti-Lrrc16c, Anti-Rgd motif, leucine rich repeats, tropomodulin domain and proline-rich containing
로그인조직 및 계약 가격 보기
모든 사진(2)
About This Item
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:50- 1:200
면역원 서열
EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RLTPR(146206)
관련 카테고리
일반 설명
The gene CARMIL2 (capping protein regulator and myosin 1 linker 2) is mapped to human chromosome 16q22.1. The encoded protein belongs to the CARMIL family of proteins. The protein has a noncanonical pleckstrin homology domain, a leucine-rich repeat domain, a helical homodimerization domain and a disordered region that contains the CBR (CP-binding region) and a proline-rich domain, which binds to class-I myosins. CARMIL2 is also referred to as RLTPR (RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein).
면역원
capping protein regulator and myosin 1 linker 2 recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-RLTPR antibody produced in rabbit has been used in western blotting.
Anti-RLTPR antibody produced in rabbit has been used in western blotting.
생화학적/생리학적 작용
CARMIL (capping protein regulator and myosin 1 linker) proteins are mainly involved in cell migration. CARMIL proteins interact with capping protein (CP). In migrating cells, CARMIL2 (also referred to as RLTPR) regulates cell polarity. It also interacts with vimentin intermediate filaments. CARMIL2 is needed for cell migration in wound healing and invadopodia-induced matrix degradation.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST82234
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
CARMIL2 is a novel molecular connection between vimentin and actin essential for cell migration and invadopodia formation.
Lanier MH, et al.
Molecular Biology of the Cell, 26, 4577-4588 (2015)
Distinct roles for CARMIL isoforms in cell migration.
Liang Y, et al.
Molecular Biology of the Cell, 20, 5290-5305 (2009)
Cell Migration and Invadopodia Formation Require a Membrane-binding Domain of CARMIL2.
Lanier MH, et al.
The Journal of Biological Chemistry, 291, 1076-1091 (2016)
Luca Bosa et al.
Scientific reports, 11(1), 5945-5945 (2021-03-17)
CARMIL2 is required for CD28-mediated co-stimulation of NF-κB signaling in T cells and its deficiency has been associated with primary immunodeficiency and, recently, very early onset inflammatory bowel disease (IBD). Here we describe the identification of novel biallelic CARMIL2 variants
T Schober et al.
Nature communications, 8, 14209-14209 (2017-01-24)
Human T-cell function is dependent on T-cell antigen receptor (TCR) and co-signalling as evidenced by immunodeficiencies affecting TCR-dependent signalling pathways. Here, we show four human patients with EBV
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.