콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

HPA036070

Sigma-Aldrich

Anti-PTK6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-BRK, Anti-PTK6 protein tyrosine kinase 6

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

recombinant expression
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PTK6(5753)

일반 설명

PTK6 (protein tyrosine kinase 6) belongs to intracellular tyrosine kinases family. It is normally expressed in epithelial cells of skin, gastrointestinal tract and prostate. It is also called as breast tumor kinase (brk), for its critical role in progression of breast cancer. The PTK6 gene is located on the human chromosome 20q13.33. PTK6 protein is expressed in two isoforms.

면역원

PTK6 protein tyrosine kinase 6 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PTK6 rabbit polyclonal antibody has been used in microarray analysis of PTK6 in breast tumor samples. It may also be used to detect protein tyrosine kinase 6 using western blot analysis in esophageal squamous cell carcinoma.

생화학적/생리학적 작용

Protein tyrosine kinase 6 regulates epithelial cell gene expression by modulating RNA binding proteins. It favours epidermal growth factor receptor signalling cascade. Mutations in kinase domain leads to activity suppression. PTK6 is effectively inhibited by tumor suppressor protein phosphatase and tensin homolog (PTEN) in human prostate cancer tissues and cell lines. PTK6 is highly expressed and up-regulated in a multitude of human carcinomas including hepatocellular carcinoma, cervical squamous carcinoma, prostate cancer and colon cancer. PTK6 mediates proteasome-mediated degradation of tumor suppressor protein by phosphorylation. With the advent of its association in human cancer, PTK6 is considered as a potential drug target for cancer chemotherapy.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST78020

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Koichi Ito et al.
Cancer research, 76(15), 4406-4417 (2016-06-16)
Patients with triple-negative breast cancers (TNBC) are at high risk for recurrent or metastatic disease despite standard treatment, underscoring the need for novel therapeutic targets and strategies. Here we report that protein tyrosine kinase 6 (PTK6) is expressed in approximately
PTK6 promotes hepatocellular carcinoma cell proliferation and invasion
Chen X, et al.
American Journal of Translational Research, 8(10), 4354-4354 (2016)
Protein tyrosine kinase 6 negatively regulates growth and promotes enterocyte differentiation in the small intestine
Haegebarth A, et al.
Molecular and Cellular Biology, 26(13), 4949-4957 (2006)
PTK6 inhibition suppresses metastases of triple-negative breast cancer via SNAIL-dependent E-cadherin regulation
Ito K, et al.
Cancer Research, 76(15), 4406-4417 (2016)
Breast tumor kinase (Brk/PTK6) is a mediator of hypoxia-associated breast cancer progression.
Anderson TMR, et al.
Cancer Research, 9(8), canres-ca0523 (2013)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.