HPA029834

Anti-PRKD1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-PKC-mu, Anti-PKCM, Anti-PKD, Anti-PRKCM, Anti-protein kinase D1
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA029834
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• 면역원 서열: RELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGER
• UniProt 수납 번호: Q15139
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PRKD1(5587)

설명

일반 설명

PRKD1 gene encodes PKD1 (protein kinase D1), that belongs to the protein kinase D family. It is a serine/threonine kinase, which is also expressed in cells of the normal mammary gland. The PRKD1 gene promoter has a CpG island covering 1.2 kb. It includes, the transcription start site and the exon 1.

면역원

protein kinase D1 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-PRKD1 has been used in immunohistochemistry.

생화학적/생리학적 작용

PRKD1 (Protein kinase D 1) is a negative modulator of cell migration. It plays an important role in cell adhesion, cell migration, vesicle transport, cell survival , signal transduction, membrane trafficking and immune function . In mammary glands, it preserves the epithelial phenotype by inhibiting epithelial-to-mesenchymal transition.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST77751

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable