콘텐츠로 건너뛰기
Merck
모든 사진(7)

주요 문서

HPA026808

Sigma-Aldrich

Anti-PRRX2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-C17orf33, Anti-G-CSF, Anti-GCSF, Anti-MGC45931, Anti-PMX2, Anti-PRX2, Anti-paired related homeobox 2

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.43

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:200- 1:500

면역원 서열

RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PRRX2(51450)

일반 설명

Paired related homeobox 2 (PRRX2) is a member of PRRX gene family, which is encoded by a gene mapped to human chromosome 9q34.1. It is primarily expressed in proliferating fetal fibroblasts and developing dermis. Apart from this, reverse transcription polymerase chain reaction (RT-PCR) analysis of human tissue revealed the presence of PRRX2 in the kidney and lung.

면역원

paired related homeobox 2 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

Paired related homeobox 2 (PRRX2), along with homeobox B13(HOXB13), plays a vital role in scarless fetal skin regeneration. Mutations in the PRRX2 gene might lead to (NAFD) syndrome. Experimental studies on NIH-3T3cells (mouse embryonic fibroblast cell line) shows that conserved PRX domain of PRRX2 facilitates cell-specific and promoter-dependent transcriptional regulation. In rat, PRRX2 facilitates embryonic pituitary development by promoting vasculogenesis.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70972

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

SPOCK1 Is a Novel Transforming Growth Factor-?-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer.
Fan LC
PLoS ONE, 11(9) (2016)
Yu-Lin Juang et al.
Molecular carcinogenesis, 55(12), 2247-2259 (2016-01-30)
TGF-β and cancer progression share a multifaceted relationship. Despite the knowledge of TGF-β biology in the development of cancer, several factors that mediate the cancer-promoting role of TGF-β continue to be identified. This study aimed to identify and characterise novel
Modulation of the human homeobox genes PRX-2 and HOXB13 in scarless fetal wounds.
Stelnicki EJ
The Journal of Investigative Dermatology, 111(1), 57-63 (1998)
Identification of domains mediating transcription activation, repression, and inhibition in the paired-related homeobox protein, Prx2 (S8).
Norris RA, Kern MJ
Dna and Cell Biology, 20(2), 89-99 (2001)
Human PRRX1 and PRRX2 genes: cloning, expression, genomic localization, and exclusion as disease genes for Nager syndrome.
Norris RA
Mammalian Genome, 11(11), 1000-1005 (2000)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.