생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:20- 1:50
면역원 서열
HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... DGKQ(1609)
일반 설명
Diacylglycerol kinase θ (DGKθ) of 941 amino acids with molecular mass of ~ 110 kDa is encoded by a gene mapped to human chromosome 4p16.3. DGKθ, also known as diacylglycerol kinase 4 (DAGK4), belongs to group V of DGK protein family. It is characterized with three cysteine-rich domains, N-terminal proline/ glycine-rich domain, a pleckstrin homology domain and Ras-associating domain. DGKθ needs polybasic cofactor and acidic phospholipids for its absolute activity. DGKθ is highly expressed in brain and at low level in the small intestine, duodenum and liver.
면역원
diacylglycerol kinase, theta 110kDa recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-DGKQ antibody produced in rabbit has been used in western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
생화학적/생리학적 작용
Diacylglycerol kinase theta (DGKθ) plays a vital role in synthesizing phosphatidic acid (PA) ligand for the nuclear receptor steroidogenic factor 1 (SF1) and functions in the regulation of adrenocortical steroidogenesis. DGKθ expression is essential for SF1/cAMP (cyclic adenosine monophosphate) stimulated CYP17A1 (Cytochrome P450 17A1) transcription and it also promotes steroid hormone production in human adrenocortical cells.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST86847
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Mammalian diacylglycerol kinases, a family of lipid kinases with signaling functions.
Topham MK, Prescott SM
The Journal of Biological Chemistry, 274(17), 11447-11450 (1999)
Cloning of a novel human diacylglycerol kinase (DGKtheta) containing three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain.
Houssa B
The Journal of Biological Chemistry, 272(16), 10422-10428 (1997)
Assignment of the human diacylglycerol kinase 4 (DAGK4) gene to chromosome 4p16.3.
Endele S
Genomics, 33(1), 145-146 (1996)
Kai Cai et al.
Journal of lipid research, 54(8), 2121-2132 (2013-04-24)
Diacylglycerol kinase (DGK)θ is a lipid kinase that phosphorylates diacylglycerol to form phosphatidic acid (PA). We have previously shown that PA is a ligand for the nuclear receptor steroidogenic factor 1 (SF1) and that cAMP-stimulated expression of SF1 target genes
Becky Tu-Sekine et al.
The Journal of biological chemistry, 287(50), 41619-41627 (2012-10-24)
Diacylglycerol kinases are important mediators of lipid signaling cascades, and insight into their regulation is of increasing interest. Using purified DGK-θ, we show that this isoform is subject to dual regulation and that the previously characterized stimulation by acidic phospholipids
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.