콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

HPA021676

Sigma-Aldrich

Anti-RACK1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Cell proliferation-inducing gene 21 protein, Anti-Guanine nucleotide-binding protein subunit beta-2-like 1, Anti-Guanine nucleotide-binding protein subunit beta-like protein 12.3, Anti-HLC-7, Anti-RACK1, Anti-Receptor for activated C kinase, Anti-Receptor of activated protein kinase C 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous glycerol solution

종 반응성

mouse, human

기술

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL

면역원 서열

CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... GNB2L1(10399)

일반 설명

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stably expressed housekeeping gene localized in alveolar macrophage and neutrophils. The gene has been predicted to encode a protein RACK1 (Receptor for activated C kinase 1). It is mapped on the telomeric position of chromosome 5q35.3.

면역원

Guanine nucleotide-binding protein subunit beta-2-like 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-GNB2L1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a scaffold protein highly involved in the binding and anchorage of protein kinase C. It has been predicted that GNB2L1 may act as a regulatory cofactor of multidrug resistance protein (MDR3/ABCB4) and is vital for the plasma membrane localization and translocation function of ABCB4.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74729

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Xiaozhu Zhang et al.
BMC molecular biology, 6, 4-4 (2005-02-22)
Reference genes, which are often referred to housekeeping genes, are frequently used to normalize mRNA levels between different samples. However the expression level of these genes may vary among tissues or cells, and may change under certain circumstances. Thus the
Yuki Ikebuchi et al.
Hepatology research : the official journal of the Japan Society of Hepatology, 39(11), 1091-1107 (2009-08-14)
Multidrug resistance protein 3 (MDR3/ABCB4), located on the bile canalicular membrane of hepatocytes, is responsible for the translocation of phosphatidylcholine across the plasma membrane, and its hereditary defect causes liver disorders, such as progressive familial intrahepatic cholestasis type 3. We
Shu Wang et al.
Molecular biology reports, 30(1), 53-60 (2003-04-12)
During a large-scale screen of a human fetal brain cDNA library, a novel human gene GNB2L1 encoding a novel RACK (receptor of activated protein kinase C) protein was isolated and sequenced. The cDNA is 1142 bp long and has a
T Ishii et al.
The European respiratory journal, 27(2), 300-306 (2006-02-03)
The stability of housekeeping genes is critical when performing gene expression studies. To date, there have been no studies that look at the stability of commonly used housekeeping genes in alveolar macrophages. Expression levels may be affected by culture, stimulation
Motoyuki Otsuka et al.
PloS one, 6(9), e24359-e24359 (2011-09-22)
MicroRNAs (miRNAs) are important regulators of gene expression that control physiological and pathological processes. A global reduction in miRNA abundance and function is a general trait of human cancers, playing a causal role in the transformed phenotype. Here, we sought

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.