콘텐츠로 건너뛰기
Merck
모든 사진(5)

주요 문서

HPA018215

Sigma-Aldrich

Anti-GUCA2A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Gap-I, Anti-Guanylate cyclase activator 2A, Anti-Guanylate cyclase-activating protein 1, Anti-Guanylin precursor

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:1000-1:2500
western blot: 0.04-0.4 μg/mL

면역원 서열

SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... GUCA2A(2980)

일반 설명

The gene guanylate cyclase activator 2A (GUCA2A) is mapped to human chromosome 1p35-p34. GUCA2A mRNA is mainly detected in the gastrointestinal tract and kidney.

면역원

Guanylin precursor recombinant protein epitope signature tag (PrEST)

생화학적/생리학적 작용

Guanylate cyclase activator 2A (GUCA2A) is mainly an intestinal peptide hormone and endogenous ligand of guanylyl cyclase C. It is produced as prohormone proguanylin. In the intestine, GUCA2A along with guanylate cyclase C receptor activates epithelial cells. Activation of this pathway results in secretion of Cl- and HCO3- and inhibition of Na+ absorption, which drives water secretion into the intestinal lumen. In the renal tissue GUCA2A elicits natriuresis, kaliuresis, and diuresis, along with increasing urinary cyclic guanosine monophosphate (cGMP) levels. GUCA2A is suggested to elevate the exrection of urinary salt and water, which results in the prevention of hypernatremia and hypervolemia following increased salt uptake by the body. The protein is also expressed in epithelial cells of the ductal system of human parotid and submandibular glands. It is released into the saliva through salivary duct cells. GUCA2A is highly expressed in salivary gland tumors. On the other hand, GUCA2A is down-regulated in colorectal cancer.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72418

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Thomas Mueller et al.
Kidney international, 82(12), 1253-1255 (2012-12-04)
According to a proposed concept of a gastrointestinal-renal natriuretic signaling axis, natriuretic peptides are released from the intestine into the circulation in response to oral salt intake and act on the kidneys as hormones to increase sodium excretion. The peptides
Øystein Brenna et al.
Cell and tissue research, 365(2), 331-341 (2016-04-06)
Guanylin (GUCA2A/Guca2a/GN) and uroguanylin (GUCA2B/Guca2b/UGN) are expressed in the gastrointestinal tract and have been implicated in ion and fluid homeostasis, satiety, abdominal pain, growth and intestinal barrier integrity. Their cellular sources are debated and include goblet cells, entero-/colonocytes, enteroendocrine (EE)
Amanda M Pattison et al.
Cancer biology & therapy, 21(9), 799-805 (2020-07-01)
Most sporadic colorectal cancer reflects acquired mutations in the adenomatous polyposis coli (APC) tumor suppressor gene, while germline heterozygosity for mutant APC produces the autosomal dominant disorder Familial Adenomatous Polyposis (FAP) with a predisposition to colorectal cancer. In these syndromes
Øystein Brenna et al.
Scandinavian journal of gastroenterology, 50(10), 1241-1252 (2015-05-17)
Activation of membrane receptor guanylate cyclase-C (GC-C) is implicated in gastrointestinal fluid and electrolyte balance, preservation of intestinal barrier integrity, anti-trophic effects and inhibition of pain sensation. To evaluate GC-C signaling, we examined the regulation of GC-C (GUCY2C/Gucy2c) and its
Yin-bo Chen et al.
Zhonghua wei chang wai ke za zhi = Chinese journal of gastrointestinal surgery, 12(5), 515-517 (2009-09-11)
To investigate the expression of guanylin in colorectal cancer. The expression of guanylin was examined by RT-PCR and semiquantitative analysis in 20 cases of colorectal cancer, and its relationship with clinical characteristics was analyzed. The positive expression of guanylin in

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.