추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SGMS2(166929)
일반 설명
SGMS2 (sphingomyelin synthase 2), also called SMS2 is one of the two isoforms of SMS enzyme, which is the last enzyme of the sphingomyelin (SM) synthesis pathway. SMS1, SMS2 and SMSr form the complete SMS family. It resides in the plasma membrane, and its cytoplasmic C-terminal is palmitoylated at its cysteine residues. It contains four motifs called D1, D2, D3 and D4, which are highly conserved in nature. It has six transmembrane α-helices, and D1 motif is located in the first exoplasmic loop and D2 in the third transmembrane α-helix.
면역원
Phosphatidylcholine:ceramide cholinephosphotransferase 2 recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
SGMS2 (sphingomyelin synthase 2) is the last enzyme in the de novo sphingomyelin (SM) synthesis pathway, which occurs in the plasma membrane. Studies in mice show that this enzyme promotes atherogenesis, and might have potential as a therapeutic target of atherosclerosis. It is also a part of the ceramide phosphoethanolamine biosynthesis. In various cancer cell types, it plays an essential role in cell growth. A compound with anti-tumor activity, called 2-hydroxyoleic acid (2OHOA) causes the activation of SGMS2, which leads to significant increase in the SM amount in plasma membrane. This activation is related to 2OHOA capability to induce cell cycle arrest and apoptosis in cancer cells. This protein also induces NF-κB pathway, which in turn has proatherogenic activity.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST73281
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Motohiro Tani et al.
Biochemical and biophysical research communications, 381(3), 328-332 (2009-02-24)
Sphingomyelin synthase (SMS) is an enzyme that catalyzes the transfer of phosphocholine from phosphatidylcholine to ceramide for sphingomyelin synthesis. Here, we show that SMS2 is palmitoylated at cysteine residues via thioester bonds in the COOH-terminal cytoplasmic tail. [3H]palmitic acid labeling
Klazien Huitema et al.
The EMBO journal, 23(1), 33-44 (2003-12-20)
Sphingomyelin (SM) is a major component of animal plasma membranes. Its production involves the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product. This reaction is catalysed by SM synthase, an enzyme whose biological potential can
Tiruneh K Hailemariam et al.
Arteriosclerosis, thrombosis, and vascular biology, 28(8), 1519-1526 (2008-06-21)
NFkappaB has long been regarded as a proatherogenic factor, mainly because of its regulation of many of the proinflammatory genes linked to atherosclerosis. Metabolism of sphingomyelin (SM) has been suggested to affect NFkappaB activation, but the mechanism is largely unknown.
Xiaogang Wang et al.
Lipids in health and disease, 10, 7-7 (2011-01-18)
Sphingomyelin synthase 2 (SMS2) contributes to de novo sphingomyelin (SM) biosynthesis. Its activity is related to SM levels in the plasma and the cell membrane. In this study, we investigated the possibility of a direct relationship between SMS and atherosclerosis.
Philipp Ternes et al.
Journal of lipid research, 50(11), 2270-2277 (2009-05-21)
Sphingolipids are vital components of eukaryotic membranes involved in the regulation of cell growth, death, intracellular trafficking, and the barrier function of the plasma membrane (PM). While sphingomyelin (SM) is the major sphingolipid in mammals, previous studies indicate that mammalian
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.