HPA010815

Anti-GLG1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-CFR-1 antibody produced in rabbit, Anti-Cysteine-rich fibroblast growth factor receptor antibody produced in rabbit, Anti-E-selectin ligand 1 antibody produced in rabbit, Anti-ESL-1 antibody produced in rabbit, Anti-Golgi apparatus protein 1 precursor antibody produced in rabbit, Anti-Golgi sialoglycoprotein MG-160 antibody produced in rabbit
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA010815
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY
• UniProt 수납 번호: Q92896
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GLG1(2734)

설명

일반 설명

GLG1 (golgi glycoprotein 1) is a type I transmembrane sialoglycoprotein, which is rich in cysteine residues. It is localized to the Golgi bodies, in the medial cisternae. This gene is located on human chromosome 16q22-q23. It is an FGF (fibroblast growth factor)-binding protein, independent of tyrosine kinase. It has a unique CFR (cysteine-rich fibroblast growth factor receptor) motif, of which 16 repeats are present in the extracellular domain. Its transmembrane domain consists of 21 amino acids, and its cytoplasmic domain has only 13 amino acids. Due to alternative splicing, a different isoform of GLG1 has an additional 24 amino acids in the cytoplasmic domain. This isoform is located in the Golgi apparatus, whereas the isoform with the shorter cytoplasmic tail is localized to the cell surface. It is ubiquitously expressed from an early embryonic stage to adulthood.

면역원

Golgi apparatus protein 1 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-GLG1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

GLG1 (golgi glycoprotein 1) binds to FGF (fibroblast growth factor), as well as to E-selectin and TGFβ (transforming growth factor β). It regulates the function of TGFβ, by modulating its maturation and secretion. This protein interacts with FGF18 at the cell surface, and positively regulates the FGF18 signaling cascade. GLG1 might act as a chaperone protein by regulating the processing and targeting of basic fibroblast growth factor (bFGF), in the cell. This protein is also associated with malignant astrocytomas in humans, and might have a role in the malignancy of these tumors. It is suggested that GLG1 aids in binding of E-selectin to myeloid cells. It might also play a role in the initiation of leukocyte endothelial contact formation, as it is expressed in microvilli of leukocytes.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71695

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)