콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA006660

Sigma-Aldrich

Anti-LMNA antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-70 kDa lamin, Anti-Lamin-A/C, Anti-Renal carcinoma antigen NY-REN-32

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... LMNA(4000)

일반 설명

Lamin A/C (LMNA) gene codes for lamin A and lamin C protein. Lamin A is a nuclear intermediate filament protein. The LMNA gene is mapped to human chromosome 1q22.

면역원

Lamin-A/C recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-LMNA antibody produced in rabbit has been used in:
  • western blotting (1:100)
  • immunostaining (1:10)
  • indirect immunofluorescence
  • confocal microscopy (1:100)

생화학적/생리학적 작용

Lamins play a key role in nuclear stability, chromatin organization, and gene expression. Lamin A (LMNA) participates in the structural organization of the nucleus. It modulates gene expression via interaction with signaling molecules and transcription factors. Different mutations in the LMNA gene results in several genetic disorders called laminopathies. Mutations in the LMNA gene are also associated with muscular dystrophies, neuropathies, dilated cardiomyopathy with conduction disease, lipodystrophies, and premature aging diseases.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70720

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Manindra Bera et al.
Biochemistry, 53(46), 7247-7258 (2014-10-25)
A- and B-type lamins are intermediate filament proteins constituting the nuclear lamina underneath the nuclear envelope thereby conferring proper shape and mechanical rigidity to the nucleus. Lamin proteins are also shown to be related diversely to basic nuclear processes. More
M A Bogdanova et al.
Tsitologiia, 56(4), 260-267 (2014-12-17)
Nuclear lamins are the major proteins of nuclear envelope and provide the strength of nuclear membrane as well as the interaction of extra-nuclear structures with components of cell nucleus. Recently, it became clear that lamins not only play a structural
Rasha A Al-Saaidi et al.
European journal of heart failure, 20(10), 1404-1412 (2018-06-27)
Lamin A/C mutations are generally believed to be associated with a severe prognosis. The aim of this study was to investigate disease expression in three affected families carrying different LMNA missense mutations. Furthermore, the potential molecular disease mechanisms of the
Anna Sowińska-Seidler et al.
Journal of applied genetics, 59(3), 281-289 (2018-05-31)
Craniosynostosis (CS) refers to the group of craniofacial malformations characterized by the premature closure of one or more cranial sutures. The disorder is clinically and genetically heterogeneous and occurs usually as an isolated trait, but can also be syndromic. In
Lu Kong et al.
Carcinogenesis, 33(4), 751-759 (2012-02-04)
Prostate cancer (PC) remains the second most common cause of cancer-related death in Western countries. A previous proteomics study suggested that the nuclear membrane protein lamin A/C to be a maker to discriminate low- and high-Gleason score tumors and to

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.