HPA005661
Anti-ADAMTS5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody produced in rabbit, Anti-ADAM-TS 11 antibody produced in rabbit, Anti-ADAM-TS 5 antibody produced in rabbit, Anti-ADAM-TS5 antibody produced in rabbit, Anti-ADAMTS-5 precursor antibody produced in rabbit, Anti-ADMP-2 antibody produced in rabbit, Anti-Aggrecanase-2 antibody produced in rabbit
로그인조직 및 계약 가격 보기
모든 사진(2)
About This Item
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:50- 1:200
면역원 서열
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ADAMTS5(11096)
일반 설명
ADAM metallopeptidase with thrombospondin motifs 5 (ADAMTS5) belongs to the ADAM protein family. It has an ADAM-like protease domain, a disintegrin-like domain and a cysteine-rich domain. ADAMTS5 lacks a transmembrane domain and is thus secreted into the extracellular matrix.
면역원
A disintegrin and metalloproteinase with thrombospondin motifs 5 precursor (ADAMTS-5) (ADAM-TS5) (Aggrecanase-2) (ADMP-2) (A disintegrin and metalloproteinase with thrombospondin motifs 11) (ADAMTS-11)
애플리케이션
Anti-ADAMTS5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
생화학적/생리학적 작용
ADAM metallopeptidase with thrombospondin motifs 5 (ADAMTS5) is involved in aggrecan, brevican and α2-macroglobulin degradation. It is one of the most important extra cellular matrix (ECM) degrading enzymes and functions in tissue degradation, remodeling and cell infiltration. ADAMTS5 cleaves cartilage aggrecan at the Glu (373)-Ala (374) bond and also in the region spanning residues Gly (1481) and Glu (1667), which represents its unique cleavage site.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST85176
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Tao Wang et al.
International journal of molecular medicine, 44(2), 630-642 (2019-06-15)
Osteoarthritis (OA) is a common and troublesome disease among the elderly, and is characterized by extracellular matrix (ECM) degradation. The function of the long non‑coding RNA X‑inactive‑specific transcript (XIST) and its working mechanism in ECM degradation remains unclear. In the
Lingqiang Chen et al.
Journal of cellular and molecular medicine, 21(12), 3347-3359 (2017-06-14)
This study was aimed to explore the role of miR-29b-3p and PGRN in chondrocyte apoptosis and the initiation and progress of osteoarthritis (OA). Both miR-29b-3p and PGRN were up-regulated in cartilage tissue from patients with OA. Transfection of miR-29b-3p mimic
Xing Li et al.
Molecular medicine reports, 18(1), 541-549 (2018-05-12)
The aim of the present study was to investigate the role of microRNA (miR)‑27a‑3p in osteoarthritis (OA). Reverse transcription‑quantitative polymerase chain reaction and western blotting were performed to determine the expression of miR‑27a‑3p and aggrecanase‑2 (ADAMTS5) in cartilage tissues from
Priscilla B Pail et al.
International immunopharmacology, 72, 62-73 (2019-04-09)
This study evaluated the role of kinin B1 and B2 receptors in the pre-clinical mouse model of oxazolone-induced atopic dermatitis. The B1 R715 or B2 HOE140 receptor antagonists were dosed at different schemes of treatment. After assessment of clinical lesion
Kevin Ngo et al.
Spine, 42(20), 1521-1528 (2017-06-02)
ADAMTS5-deficient and wild type (WT) mice were chronically exposed to tobacco smoke to investigate effects on intervertebral disc degeneration (IDD). The aim of this study was to demonstrate a role for ADAMTS5 in mediating tobacco smoking-induced IDD. We previously demonstrated
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.