콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

HPA005471

Sigma-Aldrich

Anti-PSMC4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-26S protease regulatory subunit 6B antibody produced in rabbit, Anti-MB67-interacting protein antibody produced in rabbit, Anti-MIP224 antibody produced in rabbit, Anti-Proteasome 26S subunit ATPase 4 antibody produced in rabbit, Anti-TAT-binding protein 7 antibody produced in rabbit, Anti-TBP-7 antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:50- 1:200

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PSMC4(5704)

유사한 제품을 찾으십니까? 방문 제품 비교 안내

일반 설명

The 26S proteasome is an ATP-dependent protease, which is a large complex of multiple subunits. It contains one catalytic subunit, 20S and two regulatory subunits called PA700. In humans, the PA700 contains six members, incluing PSMC4 (proteasome 26S subunit, ATPase, 4). It is also called TBP7 and the corresponding gene is located on chromosome 19q13.11-q13.13. PSMC4 is an ATPase and was initially identified as synphilin-1-interacting protein. Its molecular weight is around 50kDa.

면역원

26S protease regulatory subunit 6B recombinant protein epitope signature tag (PrEST)

Sequence
LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

Proteasome 26S subunit, ATPase, 4 (PSMC4) regulates the assembly of the 26S proteasome complex. The HbYX motif present at the C-terminal of PSMC4 is essential for the assembly of 26S complex from PA700 and 20S subunits. Interaction of PSMC4 and TRAP1 (Tumor necrosis factor receptor-associated protein-1) leads to increased stress-induced cell death and intracellular protein ubiquitination. Studies also suggest that PSMC4, along with TRAP1, regulates the quality of mitochondria targeted proteins. An insertion/deletion mutation in intron 5 of this gene is found in higher frequency in Parkinson′s disease patients than in control. This mutation is less frequent in late-onset PD patients as opposed to early onset PD patients.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86558

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Brajesh Kumar et al.
The Journal of biological chemistry, 285(50), 39523-39535 (2010-10-13)
PA700, the 19 S regulatory subcomplex of the 26 S proteasome, contains a heterohexameric ring of AAA subunits (Rpt1 to -6) that forms the binding interface with a heteroheptameric ring of α subunits (α1 to -7) of the 20 S
Claudia Wahl et al.
Journal of neural transmission (Vienna, Austria : 1996), 115(8), 1141-1148 (2008-05-01)
Dysfunction of proteasomal protein degradation is involved in neurodegeneration in Parkinson's disease (PD). Recently we identified the regulatory proteasomal subunit S6 ATPase as a novel interactor of synphilin-1, which is a substrate of the ubiquitin-ligase Parkin (PARK2) and an interacting
M R Amoroso et al.
Cell death and differentiation, 19(4), 592-604 (2011-10-08)
Tumor necrosis factor receptor-associated protein-1 (TRAP1) is a mitochondrial (MITO) antiapoptotic heat-shock protein. The information available on the TRAP1 pathway describes just a few well-characterized functions of this protein in mitochondria. However, our group's use of mass-spectrometric analysis identified TBP7
N Tanahashi et al.
Biochemical and biophysical research communications, 243(1), 229-232 (1998-02-25)
The 26S proteasome is a eukaryotic ATP-dependent protease functioning as a protein death machine. It is a large multisubunit complex, consisting of a catalytic 20S proteasome and two regulatory modules, named PA700. The PA700 complex is composed of multiple subunits
Wenyan Lu et al.
Journal of cellular biochemistry, 115(10), 1799-1807 (2014-06-07)
Emerging evidence indicates that activation of Wnt/β-catenin signaling at the cell surface results in inhibition of glycogen synthase kinase 3β (GSK3β), leading to activation of mTORC1 signaling in cancer cells. The low density lipoprotein receptor-related protein-6 (LRP6) is an essential

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.